SCOPe 2.06: Domain d3rbxd1: 3rbx D:116-244

Lineage for d3rbxd1 (3rbx D:116-244)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.9: Potassium channel NAD-binding domain [63944] (5 proteins)
   automatically mapped to Pfam PF02254

6. Protein automated matches [228498] (1 species)
   not a true protein

7. Species Methanothermobacter thermautotrophicus [TaxId:187420] [228499] (8 PDB entries)

8. Domain d3rbxd1: 3rbx D:116-244 [233432]
   Other proteins in same PDB: d3rbxa2, d3rbxb2, d3rbxc2, d3rbxd2, d3rbxe2, d3rbxf2
   automated match to d1lnqa3
   complexed with ca; mutant

Details for d3rbxd1

PDB Entry: 3rbx, 2.8 Å

PDB Description: MthK RCK domain D184N mutant, Ca2+-bound

PDB Compounds: (D:) Calcium-gated potassium channel mthK

SCOPe Domain Sequences for d3rbxd1:

Sequence; same for both SEQRES and ATOM records:

>d3rbxd1 c.2.1.9 (D:116-244) automated matches {Methanothermobacter thermautotrophicus [TaxId: 187420]}
rhvvicgwsestleclrelrgsevfvlaedenvrkkvlrsganfvhgdptrvsdlekanv
rgaravivnlesdsetihcilgirkidesvriiaeaeryenieqlrmagadqvispfvis
grlmsrsid

Timeline for d3rbxd1:

• d3rbxd1 first appeared in SCOPe 2.03
  
• d3rbxd1 appears in SCOPe 2.05
  
• d3rbxd1 appears in SCOPe 2.07
  
• d3rbxd1 appears in the current release, SCOPe 2.08