Class b: All beta proteins [48724] (126 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.6: Group I dsDNA viruses [88648] (1 family) |
Family b.121.6.1: Papovaviridae-like VP [88649] (2 proteins) |
Protein Polyomavirus coat proteins [49657] (2 species) |
Species Murine polyoma virus, strain small-plaque 16 [49658] (5 PDB entries) |
Domain d1vpnb_: 1vpn B: [23342] |
PDB Entry: 1vpn (more details), 2 Å
SCOP Domain Sequences for d1vpnb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vpnb_ b.121.6.1 (B:) Polyomavirus coat proteins {Murine polyoma virus, strain small-plaque 16} ggmevldlvtgpdsvteieaflnprmgqpptpeslteggqyygwsrginlatsdtedspg nntlptwsmaklqlpmlnedltcdtlqmweavsvktevvgsgslldvhgfnkptdtvntk gistpvegsqyhvfavggepldlqglvtdartkykeegvvtiktitkkdmvnkdqvlnpi skakldkdgmypveiwhpdpaknentryfgnytggtttppvlqftntlttvlldengvgp lckgeglylscvdimgwrvtrnydvhhwrglpryfkitlrkrwvknpyp
Timeline for d1vpnb_:
View in 3D Domains from other chains: (mouse over for more information) d1vpna_, d1vpnc_, d1vpnd_, d1vpne_ |