Lineage for d1vpnb_ (1vpn B:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 304390Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 304867Superfamily b.121.6: Group I dsDNA viruses [88648] (1 family) (S)
  5. 304868Family b.121.6.1: Papovaviridae-like VP [88649] (2 proteins)
  6. 304872Protein Polyomavirus coat proteins [49657] (2 species)
  7. 304873Species Murine polyoma virus, strain small-plaque 16 [49658] (5 PDB entries)
  8. 304880Domain d1vpnb_: 1vpn B: [23342]

Details for d1vpnb_

PDB Entry: 1vpn (more details), 2 Å

PDB Description: unassembled polyomavirus vp1 pentamer

SCOP Domain Sequences for d1vpnb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vpnb_ b.121.6.1 (B:) Polyomavirus coat proteins {Murine polyoma virus, strain small-plaque 16}
ggmevldlvtgpdsvteieaflnprmgqpptpeslteggqyygwsrginlatsdtedspg
nntlptwsmaklqlpmlnedltcdtlqmweavsvktevvgsgslldvhgfnkptdtvntk
gistpvegsqyhvfavggepldlqglvtdartkykeegvvtiktitkkdmvnkdqvlnpi
skakldkdgmypveiwhpdpaknentryfgnytggtttppvlqftntlttvlldengvgp
lckgeglylscvdimgwrvtrnydvhhwrglpryfkitlrkrwvknpyp

SCOP Domain Coordinates for d1vpnb_:

Click to download the PDB-style file with coordinates for d1vpnb_.
(The format of our PDB-style files is described here.)

Timeline for d1vpnb_: