Lineage for d1vpnb_ (1vpn B:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 11446Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily)
  4. 11447Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families) (S)
  5. 11556Family b.10.1.4: Animal virus proteins [49656] (15 proteins)
  6. 11605Protein Murine polyomavirus coat protein vp1 [49657] (1 species)
  7. 11606Species Murine polyoma virus, strain small-plaque 16 [49658] (5 PDB entries)
  8. 11613Domain d1vpnb_: 1vpn B: [23342]

Details for d1vpnb_

PDB Entry: 1vpn (more details), 2 Å

PDB Description: unassembled polyomavirus vp1 pentamer

SCOP Domain Sequences for d1vpnb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vpnb_ b.10.1.4 (B:) Murine polyomavirus coat protein vp1 {Murine polyoma virus, strain small-plaque 16}
ggmevldlvtgpdsvteieaflnprmgqpptpeslteggqyygwsrginlatsdtedspg
nntlptwsmaklqlpmlnedltcdtlqmweavsvktevvgsgslldvhgfnkptdtvntk
gistpvegsqyhvfavggepldlqglvtdartkykeegvvtiktitkkdmvnkdqvlnpi
skakldkdgmypveiwhpdpaknentryfgnytggtttppvlqftntlttvlldengvgp
lckgeglylscvdimgwrvtrnydvhhwrglpryfkitlrkrwvknpyp

SCOP Domain Coordinates for d1vpnb_:

Click to download the PDB-style file with coordinates for d1vpnb_.
(The format of our PDB-style files is described here.)

Timeline for d1vpnb_: