Class g: Small proteins [56992] (100 folds) |
Fold g.60: TSP-1 type 1 repeat [82894] (1 superfamily) disulfide-rich fold; all-beta: 3 antiparallel strands |
Superfamily g.60.1: TSP-1 type 1 repeat [82895] (2 families) automatically mapped to Pfam PF00090 |
Family g.60.1.1: TSP-1 type 1 repeat [82896] (2 proteins) |
Protein automated matches [233417] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [233418] (1 PDB entry) |
Domain d3r6ba2: 3r6b A:488-547 [233419] Other proteins in same PDB: d3r6ba1, d3r6ba3 automated match to d1lsla2 complexed with edo |
PDB Entry: 3r6b (more details), 2.4 Å
SCOPe Domain Sequences for d3r6ba2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3r6ba2 g.60.1.1 (A:488-547) automated matches {Human (Homo sapiens) [TaxId: 9606]} acpinggwgpwspwdicsvtcgggvqkrsrlcnnptpqfggkdcvgdvtenqicnkqdcp
Timeline for d3r6ba2: