Lineage for d3r6ba2 (3r6b A:488-547)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3038349Fold g.60: TSP-1 type 1 repeat [82894] (1 superfamily)
    disulfide-rich fold; all-beta: 3 antiparallel strands
  4. 3038350Superfamily g.60.1: TSP-1 type 1 repeat [82895] (2 families) (S)
    automatically mapped to Pfam PF00090
  5. 3038351Family g.60.1.1: TSP-1 type 1 repeat [82896] (2 proteins)
  6. 3038356Protein automated matches [233417] (1 species)
    not a true protein
  7. 3038357Species Human (Homo sapiens) [TaxId:9606] [233418] (1 PDB entry)
  8. 3038358Domain d3r6ba2: 3r6b A:488-547 [233419]
    Other proteins in same PDB: d3r6ba1, d3r6ba3
    automated match to d1lsla2
    complexed with edo

Details for d3r6ba2

PDB Entry: 3r6b (more details), 2.4 Å

PDB Description: Crystal Structure of Thrombospondin-1 TSR Domains 2 and 3
PDB Compounds: (A:) Thrombospondin-1

SCOPe Domain Sequences for d3r6ba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r6ba2 g.60.1.1 (A:488-547) automated matches {Human (Homo sapiens) [TaxId: 9606]}
acpinggwgpwspwdicsvtcgggvqkrsrlcnnptpqfggkdcvgdvtenqicnkqdcp

SCOPe Domain Coordinates for d3r6ba2:

Click to download the PDB-style file with coordinates for d3r6ba2.
(The format of our PDB-style files is described here.)

Timeline for d3r6ba2: