Lineage for d3r6ba1 (3r6b A:434-487)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2643035Fold g.60: TSP-1 type 1 repeat [82894] (1 superfamily)
    disulfide-rich fold; all-beta: 3 antiparallel strands
  4. 2643036Superfamily g.60.1: TSP-1 type 1 repeat [82895] (2 families) (S)
    automatically mapped to Pfam PF00090
  5. 2643045Family g.60.1.0: automated matches [233413] (1 protein)
    not a true family
  6. 2643046Protein automated matches [233414] (1 species)
    not a true protein
  7. 2643047Species Human (Homo sapiens) [TaxId:9606] [233415] (1 PDB entry)
  8. 2643048Domain d3r6ba1: 3r6b A:434-487 [233416]
    Other proteins in same PDB: d3r6ba2, d3r6ba3
    automated match to d1lsla1
    complexed with edo

Details for d3r6ba1

PDB Entry: 3r6b (more details), 2.4 Å

PDB Description: Crystal Structure of Thrombospondin-1 TSR Domains 2 and 3
PDB Compounds: (A:) Thrombospondin-1

SCOPe Domain Sequences for d3r6ba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r6ba1 g.60.1.0 (A:434-487) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qdggwshwspwsscsvtcgdgvitrirlcnspspqmngkpcegearetkackkd

SCOPe Domain Coordinates for d3r6ba1:

Click to download the PDB-style file with coordinates for d3r6ba1.
(The format of our PDB-style files is described here.)

Timeline for d3r6ba1: