![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.60: TSP-1 type 1 repeat [82894] (1 superfamily) disulfide-rich fold; all-beta: 3 antiparallel strands |
![]() | Superfamily g.60.1: TSP-1 type 1 repeat [82895] (2 families) ![]() automatically mapped to Pfam PF00090 |
![]() | Family g.60.1.0: automated matches [233413] (1 protein) not a true family |
![]() | Protein automated matches [233414] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [233415] (1 PDB entry) |
![]() | Domain d3r6ba1: 3r6b A:434-487 [233416] Other proteins in same PDB: d3r6ba2, d3r6ba3 automated match to d1lsla1 complexed with edo |
PDB Entry: 3r6b (more details), 2.4 Å
SCOPe Domain Sequences for d3r6ba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3r6ba1 g.60.1.0 (A:434-487) automated matches {Human (Homo sapiens) [TaxId: 9606]} qdggwshwspwsscsvtcgdgvitrirlcnspspqmngkpcegearetkackkd
Timeline for d3r6ba1: