![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
![]() | Family d.15.1.0: automated matches [191343] (1 protein) not a true family |
![]() | Protein automated matches [190233] (31 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187090] (152 PDB entries) |
![]() | Domain d3r66c1: 3r66 C:4-78 [233409] Other proteins in same PDB: d3r66a_, d3r66b_, d3r66c2, d3r66d2 automated match to d1z2ma1 |
PDB Entry: 3r66 (more details), 2.3 Å
SCOPe Domain Sequences for d3r66c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3r66c1 d.15.1.0 (C:4-78) automated matches {Human (Homo sapiens) [TaxId: 9606]} dltvkmlagnefqvslsssmsvselkaqitqkigvhafqqrlavhpsgvalqdrvplasq glgpgstvllvvdkc
Timeline for d3r66c1:
![]() Domains from other chains: (mouse over for more information) d3r66a_, d3r66b_, d3r66d1, d3r66d2 |