Lineage for d3r61b1 (3r61 B:4-62)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1257871Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1258750Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1259277Family a.4.5.24: Iron-dependent repressor protein [46882] (4 proteins)
    automatically mapped to Pfam PF01325
  6. 1259359Protein automated matches [233395] (2 species)
    not a true protein
  7. 1259360Species Bacillus subtilis [TaxId:1423] [233396] (3 PDB entries)
  8. 1259366Domain d3r61b1: 3r61 B:4-62 [233405]
    Other proteins in same PDB: d3r61a2, d3r61b2
    automated match to d1on1a1
    complexed with co, epe

Details for d3r61b1

PDB Entry: 3r61 (more details), 1.9 Å

PDB Description: structure of the mntr co2+ complex
PDB Compounds: (B:) Transcriptional regulator mntR

SCOPe Domain Sequences for d3r61b1:

Sequence, based on SEQRES records: (download)

>d3r61b1 a.4.5.24 (B:4-62) automated matches {Bacillus subtilis [TaxId: 1423]}
psmedyieqiymlieekgyarvsdiaealavhpssvtkmvqkldkdeyliyekyrglvl

Sequence, based on observed residues (ATOM records): (download)

>d3r61b1 a.4.5.24 (B:4-62) automated matches {Bacillus subtilis [TaxId: 1423]}
psmedyieqiymlieekgyarvsdiaealavhpssvtkmvqkldkdeyliglvl

SCOPe Domain Coordinates for d3r61b1:

Click to download the PDB-style file with coordinates for d3r61b1.
(The format of our PDB-style files is described here.)

Timeline for d3r61b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3r61b2