SCOPe 2.06: Domain d3r61a1: 3r61 A:4-62

Lineage for d3r61a1 (3r61 A:4-62)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.24: Iron-dependent repressor protein [46882] (4 proteins)
   automatically mapped to Pfam PF01325

6. Protein automated matches [233395] (2 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [233396] (3 PDB entries)

8. Domain d3r61a1: 3r61 A:4-62 [233403]
   Other proteins in same PDB: d3r61a2, d3r61b2
   automated match to d1on1a1
   complexed with co, epe

Details for d3r61a1

PDB Entry: 3r61, 1.9 Å

PDB Description: structure of the mntr co2+ complex

PDB Compounds: (A:) Transcriptional regulator mntR

SCOPe Domain Sequences for d3r61a1:

Sequence, based on SEQRES records:

>d3r61a1 a.4.5.24 (A:4-62) automated matches {Bacillus subtilis [TaxId: 1423]}
psmedyieqiymlieekgyarvsdiaealavhpssvtkmvqkldkdeyliyekyrglvl

Sequence, based on observed residues (ATOM records):

>d3r61a1 a.4.5.24 (A:4-62) automated matches {Bacillus subtilis [TaxId: 1423]}
psmedyieqiymlieekgyarvsdiaealavhpssvtkmvqkldkdeyliglvl

Timeline for d3r61a1:

• d3r61a1 first appeared in SCOPe 2.03
  
• d3r61a1 appears in SCOPe 2.05
  
• d3r61a1 appears in SCOPe 2.07
  
• d3r61a1 appears in the current release, SCOPe 2.08