Lineage for d1vpse_ (1vps E:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 11446Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily)
  4. 11447Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families) (S)
  5. 11556Family b.10.1.4: Animal virus proteins [49656] (15 proteins)
  6. 11605Protein Murine polyomavirus coat protein vp1 [49657] (1 species)
  7. 11606Species Murine polyoma virus, strain small-plaque 16 [49658] (5 PDB entries)
  8. 11611Domain d1vpse_: 1vps E: [23340]

Details for d1vpse_

PDB Entry: 1vps (more details), 1.9 Å

PDB Description: polyomavirus vp1 pentamer complexed with a disialylated hexasaccharide

SCOP Domain Sequences for d1vpse_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vpse_ b.10.1.4 (E:) Murine polyomavirus coat protein vp1 {Murine polyoma virus, strain small-plaque 16}
ggmevldlvtgpdsvteieaflnprmgqpptpeslteggqyygwsrginlatsdtedspg
nntlptwsmaklqlpmlnedltcdtlqmweavsvktevvgsgslldvhgfnkptdtvntk
gistpvegsqyhvfavggepldlqglvtdartkykeegvvtiktitkkdmvnkdqvlnpi
skakldkdgmypveiwhpdpaknentryfgnytggtttppvlqftntlttvlldengvgp
lckgeglylscvdimgwrvtrnydvhhwrglpryfkitlrkrwvk

SCOP Domain Coordinates for d1vpse_:

Click to download the PDB-style file with coordinates for d1vpse_.
(The format of our PDB-style files is described here.)

Timeline for d1vpse_: