SCOPe 2.08: Domain d3r4sa1: 3r4s A:867-1093

Lineage for d3r4sa1 (3r4s A:867-1093)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (70 species)
   not a true protein

7. Species Clostridium botulinum [TaxId:1491] [225675] (24 PDB entries)

8. Domain d3r4sa1: 3r4s A:867-1093 [233391]
   Other proteins in same PDB: d3r4sa2, d3r4sa3, d3r4sb2, d3r4sb3
   automated match to d3btaa1
   complexed with sia, slb

Details for d3r4sa1

PDB Entry: 3r4s, 2.15 Å

PDB Description: cell entry of botulinum neurotoxin type c is dependent upon interaction with two ganglioside molecules

PDB Compounds: (A:) Botulinum neurotoxin type C1

SCOPe Domain Sequences for d3r4sa1:

Sequence, based on SEQRES records:

>d3r4sa1 b.29.1.0 (A:867-1093) automated matches {Clostridium botulinum [TaxId: 1491]}
nindskilslqnrkntlvdtsgynaevseegdvqlnpifpfdfklgssgedrgkvivtqn
enivynsmyesfsisfwirinkwvsnlpgytiidsvknnsgwsigiisnflvftlkqned
seqsinfsydisnnapgynkwffvtvtnnmmgnmkiyingklidtikvkeltginfskti
tfeinkipdtglitsdsdninmwirdfyifakeldgkdinilfnslq

Sequence, based on observed residues (ATOM records):

>d3r4sa1 b.29.1.0 (A:867-1093) automated matches {Clostridium botulinum [TaxId: 1491]}
nindskilslqnrkntlvdtsgynaevseegdvqlnpifpfdfklgssgedrgkvivtqn
enivynsmyesfsisfwirinkwvsnlpgytiidsvknnsgwsigiisnflvftlkqned
seqsinfsydisnnapgynkwffvtvtnnmmgnmkiyingklidtikvkeltginfskti
tfeinkipdtgdsdninmwirdfyifakeldgkdinilfnslq

Timeline for d3r4sa1:

• d3r4sa1 first appeared in SCOPe 2.03
  
• d3r4sa1 appears in SCOPe 2.07