SCOPe 2.05: Domain d3r4sb2: 3r4s B:1094-1291

Lineage for d3r4sb2 (3r4s B:1094-1291)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.4: STI-like [50386] (3 families)

5. Family b.42.4.0: automated matches [191368] (1 protein)
   not a true family

6. Protein automated matches [190445] (5 species)
   not a true protein

7. Species Clostridium botulinum [TaxId:1491] [225676] (21 PDB entries)

8. Domain d3r4sb2: 3r4s B:1094-1291 [233390]
   Other proteins in same PDB: d3r4sa1, d3r4sb1
   automated match to d3btaa2
   complexed with sia, slb

Details for d3r4sb2

PDB Entry: 3r4s, 2.15 Å

PDB Description: cell entry of botulinum neurotoxin type c is dependent upon interaction with two ganglioside molecules

PDB Compounds: (B:) Botulinum neurotoxin type C1

SCOPe Domain Sequences for d3r4sb2:

Sequence; same for both SEQRES and ATOM records:

>d3r4sb2 b.42.4.0 (B:1094-1291) automated matches {Clostridium botulinum [TaxId: 1491]}
ytnvvkdywgndlrynkeyymvnidylnrymyansrqivfntrrnnndfnegykiiikri
rgntndtrvrggdilyfdmtinnkaynlfmknetmyadnhstediyaiglreqtkdindn
iifqiqpmnntyyyasqifksnfngenisgicsigtyrfrlggdwyrhnylvptvkqgny
aslleststhwgfvpvse

Timeline for d3r4sb2:

• d3r4sb2 first appeared in SCOPe 2.03
  
• d3r4sb2 appears in SCOPe 2.04
  
• d3r4sb2 appears in SCOPe 2.06
  
• d3r4sb2 appears in the current release, SCOPe 2.08