Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.82: ALDH-like [53719] (1 superfamily) consists of two similar domains with 3 layers (a/b/a) each; duplication core: parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.82.1: ALDH-like [53720] (3 families) binds NAD differently from other NAD(P)-dependent oxidoreductases |
Family c.82.1.0: automated matches [191448] (1 protein) not a true family |
Protein automated matches [190683] (38 species) not a true protein |
Species Agrobacterium tumefaciens [TaxId:176299] [233386] (1 PDB entry) |
Domain d3r31b_: 3r31 B: [233388] automated match to d3fg0c_ complexed with edo |
PDB Entry: 3r31 (more details), 2.15 Å
SCOPe Domain Sequences for d3r31b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3r31b_ c.82.1.0 (B:) automated matches {Agrobacterium tumefaciens [TaxId: 176299]} plkaqpkashfidgdyvedntgtpfesifpatgemiaklhaatpaiveraiasakraqke waamspmargrilkraadimrerndalstletldtgkpiqetivadptsgadafeffggi apsalngdyiplggdfaytkrvplgvcvgigawnypqqiacwkaapalvagnamvfkpse ntplgalkiaeilieaglpkglfnviqgdrdtgpllvnhpdvakvsltgsvptgrkvaaa aaghlkhvtmelggkspmivfddadiesavggamlgnfyssgqvcsngtrvfvqkkakar flenlkrrteamilgdpldyathlgplvskaqqekvlsyiekgkaegatlitgggipnnv agegayvqptvfadvtddmtiareeifgpvmcvldfddedevlaranatefglaggvfta dlarahrvvdgleagtlwintynlcpveipfggskqsgfgrensaaalehyselktvyvs tg
Timeline for d3r31b_: