Class b: All beta proteins [48724] (177 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.6: Group I dsDNA viruses [88648] (2 families) |
Family b.121.6.1: Papovaviridae-like VP [88649] (3 proteins) |
Protein Polyomavirus coat proteins [49657] (2 species) |
Species Murine polyomavirus, strain small-plaque 16 [TaxId:10634] [49658] (11 PDB entries) |
Domain d1vpsc_: 1vps C: [23338] |
PDB Entry: 1vps (more details), 1.9 Å
SCOPe Domain Sequences for d1vpsc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vpsc_ b.121.6.1 (C:) Polyomavirus coat proteins {Murine polyomavirus, strain small-plaque 16 [TaxId: 10634]} ggmevldlvtgpdsvteieaflnprmgqpptpeslteggqyygwsrginlatsdtedspg nntlptwsmaklqlpmlnedltcdtlqmweavsvktevvgsgslldvhgfnkptdtvntk gistpvegsqyhvfavggepldlqglvtdartkykeegvvtiktitkkdmvnkdqvlnpi skakldkdgmypveiwhpdpaknentryfgnytggtttppvlqftntlttvlldengvgp lckgeglylscvdimgwrvtrnydvhhwrglpryfkitlrkrwvk
Timeline for d1vpsc_:
View in 3D Domains from other chains: (mouse over for more information) d1vpsa_, d1vpsb_, d1vpsd_, d1vpse_ |