Lineage for d3qwza2 (3qwz A:107-199)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2942267Fold d.31: Cdc48 domain 2-like [54584] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2942268Superfamily d.31.1: Cdc48 domain 2-like [54585] (2 families) (S)
  5. 2942269Family d.31.1.1: Cdc48 domain 2-like [54586] (4 proteins)
  6. 2942284Protein Membrane fusion atpase p97 domain 2, P97-Nc [64254] (2 species)
  7. 2942285Species Human (Homo sapiens) [TaxId:9606] [233318] (13 PDB entries)
  8. 2942289Domain d3qwza2: 3qwz A:107-199 [233375]
    Other proteins in same PDB: d3qwza1, d3qwzb1, d3qwzb2
    automated match to d1e32a3

Details for d3qwza2

PDB Entry: 3qwz (more details), 2 Å

PDB Description: Crystal structure of FAF1 UBX-p97N-domain complex
PDB Compounds: (A:) Transitional endoplasmic reticulum ATPase

SCOPe Domain Sequences for d3qwza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qwza2 d.31.1.1 (A:107-199) Membrane fusion atpase p97 domain 2, P97-Nc {Human (Homo sapiens) [TaxId: 9606]}
dvkygkrihvlpiddtvegitgnlfevylkpyfleayrpirkgdiflvrggmravefkvv
etdpspycivapdtvihcegepikredeeesln

SCOPe Domain Coordinates for d3qwza2:

Click to download the PDB-style file with coordinates for d3qwza2.
(The format of our PDB-style files is described here.)

Timeline for d3qwza2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3qwza1