SCOPe 2.06: Domain d3quaa_: 3qua A:

Lineage for d3quaa_ (3qua A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.129: MCP/YpsA-like [102404] (1 superfamily)
   3 layers: a/b/a, parallel beta-sheet of 7 strands, order 4321567

4. Superfamily c.129.1: MCP/YpsA-like [102405] (3 families)

5. Family c.129.1.0: automated matches [233357] (1 protein)
   not a true family

6. Protein automated matches [233358] (4 species)
   not a true protein

7. Species Mycobacterium smegmatis [TaxId:246196] [233364] (1 PDB entry)

8. Domain d3quaa_: 3qua A: [233368]
   automated match to d1ydha_
   complexed with unl

Details for d3quaa_

PDB Entry: 3qua, 2.1 Å

PDB Description: crystal structure of a putative uncharacterized protein and possible molybdenum cofactor protein from mycobacterium smegmatis

PDB Compounds: (A:) Putative uncharacterized protein

SCOPe Domain Sequences for d3quaa_:

Sequence; same for both SEQRES and ATOM records:

>d3quaa_ c.129.1.0 (A:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
rqwavcvycasgpthpellelaaevgssiaargwtlvsgggnvsamgavaqaarakgght
vgvipkalvhreladvdaaelivtdtmrerkremehrsdafialpggigtleeffeawta
gylgmhdkplilldpfghydglltwlrglvptgyvsqramdslvvvdnveaaleacape

Timeline for d3quaa_:

• d3quaa_ first appeared in SCOPe 2.03
  
• d3quaa_ appears in SCOPe 2.05
  
• d3quaa_ appears in SCOPe 2.07
  
• d3quaa_ appears in the current release, SCOPe 2.08