SCOPe 2.03: Domain d3quab_: 3qua B:

Lineage for d3quab_ (3qua B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.129: MCP/YpsA-like [102404] (1 superfamily)
   3 layers: a/b/a, parallel beta-sheet of 7 strands, order 4321567

4. Superfamily c.129.1: MCP/YpsA-like [102405] (3 families)

5. Family c.129.1.0: automated matches [233357] (1 protein)
   not a true family

6. Protein automated matches [233358] (1 species)
   not a true protein

7. Species Mycobacterium smegmatis [TaxId:246196] [233364] (1 PDB entry)

8. Domain d3quab_: 3qua B: [233366]
   automated match to d1ydha_
   complexed with unl

Details for d3quab_

PDB Entry: 3qua, 2.1 Å

PDB Description: crystal structure of a putative uncharacterized protein and possible molybdenum cofactor protein from mycobacterium smegmatis

PDB Compounds: (B:) Putative uncharacterized protein

SCOPe Domain Sequences for d3quab_:

Sequence; same for both SEQRES and ATOM records:

>d3quab_ c.129.1.0 (B:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
rqwavcvycasgpthpellelaaevgssiaargwtlvsgggnvsamgavaqaarakgght
vgvipkalvhreladvdaaelivtdtmrerkremehrsdafialpggigtleeffeawta
gylgmhdkplilldpfghydglltwlrglvptgyvsqramdslvvvdnveaaleacape

Timeline for d3quab_:

• d3quab_ is new in SCOPe 2.03-stable
  
• d3quab_ appears in SCOPe 2.04
  
• d3quab_ appears in the current release, SCOPe 2.08