Lineage for d3quta_ (3qut A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1628591Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1628592Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 1629211Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 1629212Protein automated matches [190447] (45 species)
    not a true protein
  7. 1629267Species Bacteroides thetaiotaomicron [TaxId:818] [189385] (21 PDB entries)
  8. 1629276Domain d3quta_: 3qut A: [233359]
    automated match to d3qypb_
    complexed with cl, mg, mlt; mutant

Details for d3quta_

PDB Entry: 3qut (more details), 1.5 Å

PDB Description: crystal structure of pyrophosphatase from bacteroides thetaiotaomicron, asp13asn mutant, an open cap conformation
PDB Compounds: (A:) inorganic pyrophosphatase

SCOPe Domain Sequences for d3quta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3quta_ c.108.1.0 (A:) automated matches {Bacteroides thetaiotaomicron [TaxId: 818]}
hmrkklkavlfdmngvlfnsmpyhseawhqvmkthgldlsreeaymhegrtgastinivf
qrelgkeatqeeiesiyheksilfnsypeaermpgawellqkvksegltpmvvtgsgqls
llerlehnfpgmfhkelmvtafdvkygkpnpepylmalkkgglkadeavvienaplgvea
ghkagiftiavntgpldgqvlldagadllfpsmqtlcdswdtiml

SCOPe Domain Coordinates for d3quta_:

Click to download the PDB-style file with coordinates for d3quta_.
(The format of our PDB-style files is described here.)

Timeline for d3quta_: