SCOPe 2.07: Domain d3qu9a1: 3qu9 A:1-223

Lineage for d3qu9a1 (3qu9 A:1-223)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.0: automated matches [191369] (1 protein)
   not a true family

6. Protein automated matches [190447] (55 species)
   not a true protein

7. Species Bacteroides thetaiotaomicron [TaxId:818] [189385] (21 PDB entries)

8. Domain d3qu9a1: 3qu9 A:1-223 [233356]
   Other proteins in same PDB: d3qu9a2
   automated match to d3qypb_
   complexed with cl, gol, mg, tla; mutant

Details for d3qu9a1

PDB Entry: 3qu9, 1.9 Å

PDB Description: crystal structure of pyrophosphatase from bacteroides thetaiotaomicron, asp13asn mutant complexed with magnesium and tartrate

PDB Compounds: (A:) inorganic pyrophosphatase

SCOPe Domain Sequences for d3qu9a1:

Sequence; same for both SEQRES and ATOM records:

>d3qu9a1 c.108.1.0 (A:1-223) automated matches {Bacteroides thetaiotaomicron [TaxId: 818]}
mrkklkavlfdmngvlfnsmpyhseawhqvmkthgldlsreeaymhegrtgastinivfq
relgkeatqeeiesiyheksilfnsypeaermpgawellqkvksegltpmvvtgsgqlsl
lerlehnfpgmfhkelmvtafdvkygkpnpepylmalkkgglkadeavvienaplgveag
hkagiftiavntgpldgqvlldagadllfpsmqtlcdswdtim

Timeline for d3qu9a1:

• d3qu9a1 first appeared in SCOPe 2.03, called d3qu9a_
  
• d3qu9a1 appears in SCOPe 2.06
  
• d3qu9a1 appears in the current release, SCOPe 2.08