![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.108.1: HAD-like [56784] (26 families) ![]() usually contains an insertion (sub)domain after strand 1 |
![]() | Family c.108.1.0: automated matches [191369] (1 protein) not a true family |
![]() | Protein automated matches [190447] (55 species) not a true protein |
![]() | Species Bacteroides thetaiotaomicron [TaxId:818] [189385] (21 PDB entries) |
![]() | Domain d3qu4a_: 3qu4 A: [233351] Other proteins in same PDB: d3qu4d2, d3qu4e2 automated match to d3qypb_ complexed with act, cl, mg; mutant |
PDB Entry: 3qu4 (more details), 2.1 Å
SCOPe Domain Sequences for d3qu4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qu4a_ c.108.1.0 (A:) automated matches {Bacteroides thetaiotaomicron [TaxId: 818]} rkklkavlfdmagvlfnsmpyhseawhqvmkthgldlsreeaymhegrtgastinivfqr elgkeatqeeiesiyheksilfnsypeaermpgawellqkvksegltpmvvtgsgqlsll erlehnfpgmfhkelmvtafdvkygkpnpepylmalkkgglkadeavvienaplgveagh kagiftiavntgpldgqvlldagadllfpsmqtlcdswdtiml
Timeline for d3qu4a_: