SCOPe 2.04: Domain d3qora_: 3qor A:

Lineage for d3qora_ (3qor A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.15: HSP20-like chaperones [49763] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.15.1: HSP20-like chaperones [49764] (5 families)

5. Family b.15.1.0: automated matches [191643] (1 protein)
   not a true family

6. Protein automated matches [191181] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [233346] (1 PDB entry)

8. Domain d3qora_: 3qor A: [233347]
   automated match to d1wgva_
   complexed with act

Details for d3qora_

PDB Entry: 3qor, 1.75 Å

PDB Description: Crystal structure of human nuclear migration protein NudC

PDB Compounds: (A:) Nuclear migration protein nudC

SCOPe Domain Sequences for d3qora_:

Sequence; same for both SEQRES and ATOM records:

>d3qora_ b.15.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gsssklkpnlgngadlpnyrwtqtlseldlavpfcvnfrlkgkdmvvdiqrrhlrvglkg
qpaiidgelynevkveesswliadgavvtvhlekinkmewwsrlvssdpeintkkinpen

Timeline for d3qora_:

• d3qora_ first appeared in SCOPe 2.03
  
• d3qora_ appears in SCOPe 2.05
  
• d3qora_ appears in the current release, SCOPe 2.08, called d3qora1