Lineage for d3qora_ (3qor A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1529991Fold b.15: HSP20-like chaperones [49763] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 1529992Superfamily b.15.1: HSP20-like chaperones [49764] (5 families) (S)
  5. 1530087Family b.15.1.0: automated matches [191643] (1 protein)
    not a true family
  6. 1530088Protein automated matches [191181] (4 species)
    not a true protein
  7. 1530089Species Human (Homo sapiens) [TaxId:9606] [233346] (1 PDB entry)
  8. 1530090Domain d3qora_: 3qor A: [233347]
    automated match to d1wgva_
    complexed with act

Details for d3qora_

PDB Entry: 3qor (more details), 1.75 Å

PDB Description: Crystal structure of human nuclear migration protein NudC
PDB Compounds: (A:) Nuclear migration protein nudC

SCOPe Domain Sequences for d3qora_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qora_ b.15.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gsssklkpnlgngadlpnyrwtqtlseldlavpfcvnfrlkgkdmvvdiqrrhlrvglkg
qpaiidgelynevkveesswliadgavvtvhlekinkmewwsrlvssdpeintkkinpen

SCOPe Domain Coordinates for d3qora_:

Click to download the PDB-style file with coordinates for d3qora_.
(The format of our PDB-style files is described here.)

Timeline for d3qora_: