Lineage for d3qn0c_ (3qn0 C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2966179Fold d.96: T-fold [55619] (2 superfamilies)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
    tunnel-shaped: its known members form wide oligomeric barrels different sizes
  4. 2966180Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) (S)
    bind purine or pterin in topologically similar sites between subunits
  5. 2966888Family d.96.1.0: automated matches [227243] (1 protein)
    not a true family
  6. 2966889Protein automated matches [227009] (16 species)
    not a true protein
  7. 2966942Species Escherichia coli [TaxId:469008] [230194] (6 PDB entries)
  8. 2966968Domain d3qn0c_: 3qn0 C: [233338]
    automated match to d3qn0a_
    complexed with zn

Details for d3qn0c_

PDB Entry: 3qn0 (more details), 2.34 Å

PDB Description: structure of 6-pyruvoyltetrahydropterin synthase
PDB Compounds: (C:) 6-carboxy-5,6,7,8-tetrahydropterin synthase

SCOPe Domain Sequences for d3qn0c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qn0c_ d.96.1.0 (C:) automated matches {Escherichia coli [TaxId: 469008]}
sttlfkdftfeaahrlphvpeghkcgrlhghsfmvrleitgevdphtgwiidfaelkaaf
kptyerldhhylndipglenptsevlakwiwdqvkpvvpllsavmvketctagciyr

SCOPe Domain Coordinates for d3qn0c_:

Click to download the PDB-style file with coordinates for d3qn0c_.
(The format of our PDB-style files is described here.)

Timeline for d3qn0c_: