Lineage for d1b35a_ (1b35 A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2430785Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2431062Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2431063Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins)
    the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
    there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)
  6. 2431108Protein Insect picorna-like virus coat proteins [49654] (1 species)
    different genetic order of VP segments due to extensive genome shuffling
  7. 2431109Species Cricket paralysis virus [TaxId:12136] [49655] (1 PDB entry)
  8. 2431111Domain d1b35a_: 1b35 A: [23333]

Details for d1b35a_

PDB Entry: 1b35 (more details), 2.4 Å

PDB Description: cricket paralysis virus (crpv)
PDB Compounds: (A:) protein (cricket paralysis virus, vp1)

SCOPe Domain Sequences for d1b35a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b35a_ b.121.4.1 (A:) Insect picorna-like virus coat proteins {Cricket paralysis virus [TaxId: 12136]}
vmgedqqiprneaqhgvhpisidthrisnnwspqamcigekvvsirqlikrfgifgdant
lqadgssfvvapftvtsptktltstrnytqfdyyyylyafwrgsmrikmvaetqdgtgtp
rkktnftwfvrmfnslqdsfnslistsssavtttvlpsgtinmgpstqvidptvegliev
evpyynishitpavtiddgtpsmedylkghsppclltfsprdsisatnhiitasfmralg
ddfsfmyllgvpplvnvara

SCOPe Domain Coordinates for d1b35a_:

Click to download the PDB-style file with coordinates for d1b35a_.
(The format of our PDB-style files is described here.)

Timeline for d1b35a_: