![]() | Class b: All beta proteins [48724] (93 folds) |
![]() | Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily) |
![]() | Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families) ![]() |
![]() | Family b.10.1.3: Insect virus proteins [49647] (3 proteins) |
![]() | Protein Cricket paralysis virus (CRPV) [49654] (1 species) |
![]() | Species Host: australian black field cricket (Teleogryllus commodus) [49655] (1 PDB entry) |
![]() | Domain d1b35a_: 1b35 A: [23333] |
PDB Entry: 1b35 (more details), 2.4 Å
SCOP Domain Sequences for d1b35a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b35a_ b.10.1.3 (A:) Cricket paralysis virus (CRPV) {Host: australian black field cricket (Teleogryllus commodus)} vmgedqqiprneaqhgvhpisidthrisnnwspqamcigekvvsirqlikrfgifgdant lqadgssfvvapftvtsptktltstrnytqfdyyyylyafwrgsmrikmvaetqdgtgtp rkktnftwfvrmfnslqdsfnslistsssavtttvlpsgtinmgpstqvidptvegliev evpyynishitpavtiddgtpsmedylkghsppclltfsprdsisatnhiitasfmralg ddfsfmyllgvpplvnvara
Timeline for d1b35a_: