Lineage for d1dnva_ (1dnv A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2086376Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2087350Superfamily b.121.5: ssDNA viruses [88645] (3 families) (S)
  5. 2087543Family b.121.5.3: Densovirinae-like VP [88647] (1 protein)
    automatically mapped to Pfam PF02336
  6. 2087544Protein Densovirus capsid protein [49652] (1 species)
  7. 2087545Species Galleria mellonella densovirus [TaxId:37138] [49653] (1 PDB entry)
  8. 2087546Domain d1dnva_: 1dnv A: [23332]

Details for d1dnva_

PDB Entry: 1dnv (more details), 3.6 Å

PDB Description: parvovirus (densovirus) from galleria mellonella
PDB Compounds: (A:) galleria mellonella densovirus capsid protein

SCOPe Domain Sequences for d1dnva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dnva_ b.121.5.3 (A:) Densovirus capsid protein {Galleria mellonella densovirus [TaxId: 37138]}
vyiiprpfsnfgkklstytkshkfmifglannvigptgtgttavnrllttclaeipwqkl
plymnqsefdllppgsrvvecnvkvifrtnriafetsstvtkqatlnqisnvqtaiglnk
lgwginraftafqsdqpmiptattapkyepvtgdtgyrgmiadyygadstndtafgnagn
yphhqvssftflqnyycmyqqtnqgtggwpclaehlqqfdsktvnnqclidvtykpkmgl
iksplnykiigqptvkgtisvgdnlvnmrgavvtnppeatqnvaesthnltrnfpadlfn
iysdieksqvlhkgpwghenpqiqpsvhigiqavpalttgallinssplnswtdsmgyid
vmssctvmeaqpthfpfsteantnpgntiyrinltpnsltsafnglygngatlgn

SCOPe Domain Coordinates for d1dnva_:

Click to download the PDB-style file with coordinates for d1dnva_.
(The format of our PDB-style files is described here.)

Timeline for d1dnva_: