Class a: All alpha proteins [46456] (290 folds) |
Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
Family a.100.1.1: Hydroxyisobutyrate and 6-phosphogluconate dehydrogenase domain [48180] (3 proteins) Hydroxyisobutyrate dehydrogenase domain is similar to one structural repeat in the 6-phosphogluconate dehydrogenase domain |
Protein Hydroxyisobutyrate dehydrogenase [101357] (4 species) forms similar dimeric and tetrameric structures to the 6-phosphogluconate dehydrogenase domain and its dimer, respectively |
Species Pseudomonas aeruginosa [TaxId:287] [158733] (2 PDB entries) Uniprot Q9I5I6 163-296 |
Domain d3q3ca2: 3q3c A:163-296 [233311] Other proteins in same PDB: d3q3ca1 automated match to d3obba1 complexed with nad |
PDB Entry: 3q3c (more details), 2.3 Å
SCOPe Domain Sequences for d3q3ca2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3q3ca2 a.100.1.1 (A:163-296) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} pdgagqvakvcnnqllavlmigtaeamalgvangleakvlaeimrrssggnwalevynpw pgvmenapasrdysggfmaqlmakdlglaqeaaqasasstpmgslalslyrlllkqgyae rdfsvvqklfdptq
Timeline for d3q3ca2: