Lineage for d3q3ca1 (3q3c A:2-162)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2844998Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (19 proteins)
    the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest
    C-terminal domains also show some similarity
  6. 2845080Protein Hydroxyisobutyrate dehydrogenase [102171] (4 species)
  7. 2845083Species Pseudomonas aeruginosa [TaxId:287] [159424] (2 PDB entries)
    Uniprot Q9I5I6 1-162
  8. 2845084Domain d3q3ca1: 3q3c A:2-162 [233310]
    Other proteins in same PDB: d3q3ca2
    automated match to d3obba2
    complexed with nad

Details for d3q3ca1

PDB Entry: 3q3c (more details), 2.3 Å

PDB Description: Crystal structure of a serine dehydrogenase from Pseudomonas aeruginosa pao1 in complex with NAD
PDB Compounds: (A:) Probable 3-hydroxyisobutyrate dehydrogenase

SCOPe Domain Sequences for d3q3ca1:

Sequence, based on SEQRES records: (download)

>d3q3ca1 c.2.1.6 (A:2-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]}
kqiafiglghmgapmatnllkagyllnvfdlvqsavdglvaagasaarsardavqgadvv
ismlpasqhveglyldddgllahiapgtlvlecstiaptsarkihaaarerglamldapv
sggtagaaagtltfmvggdaealekarplfeamgrnifhag

Sequence, based on observed residues (ATOM records): (download)

>d3q3ca1 c.2.1.6 (A:2-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]}
kqiafiglghmgapmatnllkagyllnvfdlvqsavdglvaagasaarsardavqgadvv
ismlpasqhveglylddgllahiapgtlvlecstiaptsarkihaaarerglamldapvs
ggtagaaagtltfmvggdaealekarplfeamgrnifhag

SCOPe Domain Coordinates for d3q3ca1:

Click to download the PDB-style file with coordinates for d3q3ca1.
(The format of our PDB-style files is described here.)

Timeline for d3q3ca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3q3ca2