Lineage for d1f8v.3 (1f8v C:,F:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 225197Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily)
    sandwich; 8 strands in 2 sheets; jelly-roll
    variations: some members have additional 1-2 strands
  4. 225198Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families) (S)
  5. 225306Family b.10.1.3: Insect virus proteins [49647] (3 proteins)
  6. 225315Protein Nodavirus capsid protein [49648] (3 species)
  7. 225324Species Pariacoto virus [TaxId:103782] [49651] (1 PDB entry)
  8. 225327Domain d1f8v.3: 1f8v C:,F: [23331]
    complexed with ca, so4

Details for d1f8v.3

PDB Entry: 1f8v (more details), 3 Å

PDB Description: the structure of pariacoto virus reveals a dodecahedral cage of duplex rna

SCOP Domain Sequences for d1f8v.3:

Sequence; same for both SEQRES and ATOM records: (download)

>g1f8v.3 b.10.1.3 (C:,F:) Nodavirus capsid protein {Pariacoto virus}
rltdaglaflkcafaapdfsvdpgkgipdnfhgrtlaikdcnttsvvftpntdtyivvap
vpgfayfraevavgaqpttfvgvpyptyatnfgagsqnglpavnnyskfryasmacglyp
tsnmmqfsgsvqvwrvdlnlseavnpavtaitpapgvfanfvdkringlrgirplaprdn
ysgnfidgaytfafdkstdfewcdfvrslefsesnvlgaatamkllapgggtdttltglg
nvntlvykistptgavntailrtwncielqpytdsalfqfsgvsppfdplalecyhnlkm
rfpvavssrenXskfwegvlrvlnqisgtlsvip

SCOP Domain Coordinates for d1f8v.3:

Click to download the PDB-style file with coordinates for d1f8v.3.
(The format of our PDB-style files is described here.)

Timeline for d1f8v.3: