SCOP 1.61: Domain d1f8v.3: 1f8v C:,F:

Lineage for d1f8v.3 (1f8v C:,F:)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily)

4. Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families)

5. Family b.10.1.3: Insect virus proteins [49647] (3 proteins)

6. Protein Nodavirus capsid protein [49648] (3 species)

7. Species Pariacoto virus [TaxId:103782] [49651] (1 PDB entry)

8. Domain d1f8v.3: 1f8v C:,F: [23331]

Details for d1f8v.3

PDB Entry: 1f8v, 3 Å

PDB Description: the structure of pariacoto virus reveals a dodecahedral cage of duplex rna

SCOP Domain Sequences for d1f8v.3:

Sequence; same for both SEQRES and ATOM records:

>g1f8v.3 b.10.1.3 (C:,F:) Nodavirus capsid protein {Pariacoto virus}
rltdaglaflkcafaapdfsvdpgkgipdnfhgrtlaikdcnttsvvftpntdtyivvap
vpgfayfraevavgaqpttfvgvpyptyatnfgagsqnglpavnnyskfryasmacglyp
tsnmmqfsgsvqvwrvdlnlseavnpavtaitpapgvfanfvdkringlrgirplaprdn
ysgnfidgaytfafdkstdfewcdfvrslefsesnvlgaatamkllapgggtdttltglg
nvntlvykistptgavntailrtwncielqpytdsalfqfsgvsppfdplalecyhnlkm
rfpvavssrenXskfwegvlrvlnqisgtlsvip

Timeline for d1f8v.3:

• d1f8v.3 first appeared (with stable ids) in SCOP 1.55
  
• d1f8v.3 appears in SCOP 1.59
  
• d1f8v.3 appears in SCOP 1.63
  
• d1f8v.3 appears in the current release, SCOPe 2.08