![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
![]() | Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
![]() | Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
![]() | Protein automated matches [226831] (73 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [225003] (13 PDB entries) |
![]() | Domain d3q19a2: 3q19 A:103-228 [233309] Other proteins in same PDB: d3q19a1, d3q19b1 automated match to d1eema1 complexed with cl, gsh |
PDB Entry: 3q19 (more details), 1.9 Å
SCOPe Domain Sequences for d3q19a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3q19a2 a.45.1.0 (A:103-228) automated matches {Human (Homo sapiens) [TaxId: 9606]} fpydpyerarqkmllelfskvphltkeclvalrsgrestnlkaalrqefsnleeileyqn ttffggtsismidyllwpwferldvygildcvshtpalrlwisamkwdptvsallmdksi fqgfln
Timeline for d3q19a2: