Class a: All alpha proteins [46456] (286 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
Protein automated matches [226831] (51 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225003] (11 PDB entries) |
Domain d3q19b2: 3q19 B:103-239 [233306] Other proteins in same PDB: d3q19a1, d3q19b1 automated match to d1eema1 complexed with cl, gsh |
PDB Entry: 3q19 (more details), 1.9 Å
SCOPe Domain Sequences for d3q19b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3q19b2 a.45.1.0 (B:103-239) automated matches {Human (Homo sapiens) [TaxId: 9606]} fpydpyerarqkmllelfskvphltkeclvalrsgrestnlkaalrqefsnleeileyqn ttffggtsismidyllwpwferldvygildcvshtpalrlwisamkwdptvsallmdksi fqgflnlyfqnnpnafd
Timeline for d3q19b2: