SCOPe 2.05: Domain d3q19b2: 3q19 B:103-239

Lineage for d3q19b2 (3q19 B:103-239)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (51 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225003] (11 PDB entries)

8. Domain d3q19b2: 3q19 B:103-239 [233306]
   Other proteins in same PDB: d3q19a1, d3q19b1
   automated match to d1eema1
   complexed with cl, gsh

Details for d3q19b2

PDB Entry: 3q19, 1.9 Å

PDB Description: Human Glutathione Transferase O2

PDB Compounds: (B:) Glutathione S-transferase omega-2

SCOPe Domain Sequences for d3q19b2:

Sequence; same for both SEQRES and ATOM records:

>d3q19b2 a.45.1.0 (B:103-239) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fpydpyerarqkmllelfskvphltkeclvalrsgrestnlkaalrqefsnleeileyqn
ttffggtsismidyllwpwferldvygildcvshtpalrlwisamkwdptvsallmdksi
fqgflnlyfqnnpnafd

Timeline for d3q19b2:

• d3q19b2 first appeared in SCOPe 2.03
  
• d3q19b2 appears in SCOPe 2.04
  
• d3q19b2 appears in SCOPe 2.06
  
• d3q19b2 appears in the current release, SCOPe 2.08