Lineage for d3pxvc_ (3pxv C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963273Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily)
    core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243
  4. 2963274Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families) (S)
  5. 2963435Family d.90.1.0: automated matches [191446] (1 protein)
    not a true family
  6. 2963436Protein automated matches [190672] (32 species)
    not a true protein
  7. 2963476Species Desulfitobacterium hafniense [TaxId:272564] [233297] (1 PDB entry)
  8. 2963479Domain d3pxvc_: 3pxv C: [233300]
    Other proteins in same PDB: d3pxvb2, d3pxvd2
    automated match to d3eo8f_
    complexed with fmn

Details for d3pxvc_

PDB Entry: 3pxv (more details), 2.3 Å

PDB Description: Crystal structure of a Nitroreductase with bound FMN (Dhaf_2018) from Desulfitobacterium hafniense DCB-2 at 2.30 A resolution
PDB Compounds: (C:) Nitroreductase

SCOPe Domain Sequences for d3pxvc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pxvc_ d.90.1.0 (C:) automated matches {Desulfitobacterium hafniense [TaxId: 272564]}
mmnetlkviaeryscrdfknempsdellqaiaeaaiqapsgmnrqawrvivvknkelmqe
meaeglaylagmedqssynrimerggrlfygapcmivvpidptqygpalvdcgilcqtia
laatslgianimcgytglafasglraeefskrlgfpegyafgcsvllghanttkpphvpd
kdkityve

SCOPe Domain Coordinates for d3pxvc_:

Click to download the PDB-style file with coordinates for d3pxvc_.
(The format of our PDB-style files is described here.)

Timeline for d3pxvc_: