Lineage for d3pxtf_ (3pxt F:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1554689Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 1554711Superfamily b.69.2: YVTN repeat-like/Quinoprotein amine dehydrogenase [50969] (4 families) (S)
  5. 1554747Family b.69.2.0: automated matches [232760] (1 protein)
    not a true family
  6. 1554748Protein automated matches [232762] (1 species)
    not a true protein
  7. 1554749Species Paracoccus denitrificans [TaxId:318586] [232763] (18 PDB entries)
  8. 1554781Domain d3pxtf_: 3pxt F: [233296]
    Other proteins in same PDB: d3pxtc_, d3pxte_
    automated match to d2madh_
    complexed with act, ca, cmo, hec, na, pg6

Details for d3pxtf_

PDB Entry: 3pxt (more details), 2.16 Å

PDB Description: crystal structure of ferrous co adduct of maug in complex with pre- methylamine dehydrogenase
PDB Compounds: (F:) Methylamine dehydrogenase heavy chain

SCOPe Domain Sequences for d3pxtf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pxtf_ b.69.2.0 (F:) automated matches {Paracoccus denitrificans [TaxId: 318586]}
qetqgqaaaraaaadlaagqddeprileapapdarrvyvndpahfaavtqqfvidgeagr
vigmidggflpnpvvaddgsfiahastvfsriargertdyvevfdpvtllptadielpda
prflvgtypwmtsltpdgktllfyqfspapavgvvdlegkafkrmldvpdcyhifptapd
tffmhcrdgslakvafgtegtpeithtevfhpedeflinhpaysqkagrlvwptytgkih
qidlssgdakflpavealteaeradgwrpggwqqvayhraldriyllvdqrdewrhktas
rfvvvldaktgerlakfemgheidsinvsqdekpllyalstgdktlyihdaesgeelrsv
nqlghgpqvittadmg

SCOPe Domain Coordinates for d3pxtf_:

Click to download the PDB-style file with coordinates for d3pxtf_.
(The format of our PDB-style files is described here.)

Timeline for d3pxtf_: