Lineage for d3pxna1 (3pxn A:4-322)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113903Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2113904Protein automated matches [190123] (130 species)
    not a true protein
  7. 2114132Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [225598] (9 PDB entries)
  8. 2114139Domain d3pxna1: 3pxn A:4-322 [233292]
    Other proteins in same PDB: d3pxna2
    automated match to d3dc4a_
    complexed with adp, mn

Details for d3pxna1

PDB Entry: 3pxn (more details), 2.6 Å

PDB Description: Crystal structure of the Drosophila kinesin family member Kin10/NOD in complex with divalent manganese and ADP
PDB Compounds: (A:) Kinesin-like protein Nod

SCOPe Domain Sequences for d3pxna1:

Sequence, based on SEQRES records: (download)

>d3pxna1 c.37.1.0 (A:4-322) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
aklsavriavreapyrqflgrrepsvvqfppwsdgkslivdqnefhfdhafpatisqdem
yqalilplvdkllegfqctalaygqtgtgksysmgmtppgeilpehlgilpralgdifer
vtarqennkdaiqvyasfieiynekpfdllgstphmpmvaarcqrctclplhsqadlhhi
lelgtrnrrvrptnmnsnssrshaivtihvkskthhsrmnivdlagsegvrrtghegvar
qegvninlgllsinkvvmsmaaghtvipyrdsvlttvlqasltaqsyltflacisphqcd
lsetlstlrfgtsakklrl

Sequence, based on observed residues (ATOM records): (download)

>d3pxna1 c.37.1.0 (A:4-322) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
aklsavriavreapyrpsvvqfppwsdgkslivdqnefhfdhafpatisqdemyqalilp
lvdkllegfqctalaygqtgtgksysmgmtppgeilpehlgilpralgdifervtarqen
nkdaiqvyasfieiynekpfdllgstphmpmvaarcqrctclplhsqadlhhilelgtrn
rrsrshaivtihvkskthhsrmnivdlagsegvvninlgllsinkvvmsmaaghtvipyr
dsvlttvlqasltaqsyltflacisphqcdlsetlstlrfgtsakklrl

SCOPe Domain Coordinates for d3pxna1:

Click to download the PDB-style file with coordinates for d3pxna1.
(The format of our PDB-style files is described here.)

Timeline for d3pxna1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3pxna2