Lineage for d3pwia2 (3pwi A:138-446)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2836768Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2836928Family c.1.11.2: D-glucarate dehydratase-like [51609] (15 proteins)
  6. 2837122Protein automated matches [226997] (13 species)
    not a true protein
  7. 2837186Species Escherichia coli [TaxId:444449] [233282] (2 PDB entries)
  8. 2837190Domain d3pwia2: 3pwi A:138-446 [233290]
    Other proteins in same PDB: d3pwia1, d3pwib1
    automated match to d1ec7a1
    complexed with glr, gol, mg; mutant

Details for d3pwia2

PDB Entry: 3pwi (more details), 2.23 Å

PDB Description: Crystal structure of the mutant P34A of D-Glucarate dehydratase from Escherichia coli complexed with product 5-keto-4-deoxy-D-Glucarate
PDB Compounds: (A:) glucarate dehydratase

SCOPe Domain Sequences for d3pwia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pwia2 c.1.11.2 (A:138-446) automated matches {Escherichia coli [TaxId: 444449]}
dgqqrsevemlgylffvgnrkatplpyqsqpddscdwyrlrheeamtpdavvrlaeaaye
kygfndfklkggvlageeeaesivalaqrfpqaritldpngawslneaikigkylkgsla
yaedpcgaeqgfsgrevmaefrratglptatnmiatdwrqmghtlslqsvdipladphfw
tmqgsvrvaqmchefgltwgshsnnhfdislamfthvaaaapgkitaidthwiwqegnqr
ltkepfeikgglvqvpekpglgveidmdqvmkahelyqkhglgarddamgmqylipgwtf
dnkrpcmvr

SCOPe Domain Coordinates for d3pwia2:

Click to download the PDB-style file with coordinates for d3pwia2.
(The format of our PDB-style files is described here.)

Timeline for d3pwia2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3pwia1