SCOPe 2.08: Domain d3pwia2: 3pwi A:138-446

Lineage for d3pwia2 (3pwi A:138-446)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.2: D-glucarate dehydratase-like [51609] (15 proteins)

6. Protein automated matches [226997] (13 species)
   not a true protein

7. Species Escherichia coli [TaxId:444449] [233282] (2 PDB entries)

8. Domain d3pwia2: 3pwi A:138-446 [233290]
   Other proteins in same PDB: d3pwia1, d3pwib1
   automated match to d1ec7a1
   complexed with glr, gol, mg; mutant

Details for d3pwia2

PDB Entry: 3pwi, 2.23 Å

PDB Description: Crystal structure of the mutant P34A of D-Glucarate dehydratase from Escherichia coli complexed with product 5-keto-4-deoxy-D-Glucarate

PDB Compounds: (A:) glucarate dehydratase

SCOPe Domain Sequences for d3pwia2:

Sequence; same for both SEQRES and ATOM records:

>d3pwia2 c.1.11.2 (A:138-446) automated matches {Escherichia coli [TaxId: 444449]}
dgqqrsevemlgylffvgnrkatplpyqsqpddscdwyrlrheeamtpdavvrlaeaaye
kygfndfklkggvlageeeaesivalaqrfpqaritldpngawslneaikigkylkgsla
yaedpcgaeqgfsgrevmaefrratglptatnmiatdwrqmghtlslqsvdipladphfw
tmqgsvrvaqmchefgltwgshsnnhfdislamfthvaaaapgkitaidthwiwqegnqr
ltkepfeikgglvqvpekpglgveidmdqvmkahelyqkhglgarddamgmqylipgwtf
dnkrpcmvr

Timeline for d3pwia2:

• d3pwia2 first appeared in SCOPe 2.03
  
• d3pwia2 appears in SCOPe 2.07