Lineage for d1f8v.1 (1f8v A:,D:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 304390Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 304471Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (7 families) (S)
  5. 304743Family b.121.4.4: Nodaviridae-like VP [88638] (1 protein)
  6. 304744Protein Alphanodavirus capsid protein [49648] (3 species)
  7. 304753Species Pariacoto virus [TaxId:103782] [49651] (1 PDB entry)
  8. 304754Domain d1f8v.1: 1f8v A:,D: [23329]

Details for d1f8v.1

PDB Entry: 1f8v (more details), 3 Å

PDB Description: the structure of pariacoto virus reveals a dodecahedral cage of duplex rna

SCOP Domain Sequences for d1f8v.1:

Sequence, based on SEQRES records: (download)

>g1f8v.1 b.121.4.4 (A:,D:) Alphanodavirus capsid protein {Pariacoto virus}
nrrnkarkvvsrstalvpmapasqrtgpaprkprkrnqalvrnprltdaglaflkcafaa
pdfsvdpgkgipdnfhgrtlaikdcnttsvvftpntdtyivvapvpgfayfraevavgaq
pttfvgvpyptyatnfgagsqnglpavnnyskfryasmacglyptsnmmqfsgsvqvwrv
dlnlseavnpavtaitpapgvfanfvdkringlrgirplaprdnysgnfidgaytfafdk
stdfewcdfvrslefsesnvlgaatamkllapgggtdttltglgnvntlvykistptgav
ntailrtwncielqpytdsalfqfsgvsppfdplalecyhnlkmrfpvavssrenXskfw
egvlrvlnqisgtlsvipgpvgtisagvhqltgmym

Sequence, based on observed residues (ATOM records): (download)

>g1f8v.1 b.121.4.4 (A:,D:) Alphanodavirus capsid protein {Pariacoto virus}
nrrnkarkvvsrstalvpmapasqrtgpaprkprkrnqalvrnprltdaglaflkcafaa
pdfsvdpgkgipdnfhgrtlaikdcnttsvvftpntdtyivvapvpgfayfraevavgaq
pttfvgvpyptyatnfgagsqnglpavnnyskfryasmacglyptsnmmqfsgsvqvwrv
dlnlseavnpavtaitpapgvfanfvdkringlrgirplaprdnysgnfidgaytfafdk
stdfewcdfvrslefsesnvlgaatamkllapgggtdttltglgnvntlvykistptgav
ntailrtwncielqpytdsalfqfsgvsppfdplalecyhnlkmrfpvavssrenXskfw
egvlrvlnqisgtlhqltgmym

SCOP Domain Coordinates for d1f8v.1:

Click to download the PDB-style file with coordinates for d1f8v.1.
(The format of our PDB-style files is described here.)

Timeline for d1f8v.1: