Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
Protein automated matches [226922] (95 species) not a true protein |
Species Escherichia coli [TaxId:444449] [233278] (2 PDB entries) |
Domain d3pwgc1: 3pwg C:4-137 [233287] Other proteins in same PDB: d3pwga2, d3pwgb2, d3pwgd2 automated match to d1ec7a2 complexed with glr, gol, mg; mutant |
PDB Entry: 3pwg (more details), 2 Å
SCOPe Domain Sequences for d3pwgc1:
Sequence, based on SEQRES records: (download)
>d3pwgc1 d.54.1.0 (C:4-137) automated matches {Escherichia coli [TaxId: 444449]} qfttpvvtemqvipvaghdsmlmnlggahaafftrniviikdnsghtgvgeipggekirk tledaiplvvgktlgeyknvltlvrntfadrdaggrglqtfdlrttihvvtgieaamldl lgqhlgvnvasllg
>d3pwgc1 d.54.1.0 (C:4-137) automated matches {Escherichia coli [TaxId: 444449]} qfttpvvtemqvipvaghdsmlmnlggahaafftrniviikdnsghtgvgeipggekirk tledaiplvvgktlgeyknvltlvrntfadrdlrttihvvtgieaamldllgqhlgvnva sllg
Timeline for d3pwgc1: