| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) ![]() |
| Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
| Protein automated matches [226922] (95 species) not a true protein |
| Species Escherichia coli [TaxId:444449] [233278] (2 PDB entries) |
| Domain d3pwgd1: 3pwg D:5-137 [233285] Other proteins in same PDB: d3pwga2, d3pwgb2, d3pwgd2 automated match to d1ec7a2 complexed with glr, gol, mg; mutant |
PDB Entry: 3pwg (more details), 2 Å
SCOPe Domain Sequences for d3pwgd1:
Sequence, based on SEQRES records: (download)
>d3pwgd1 d.54.1.0 (D:5-137) automated matches {Escherichia coli [TaxId: 444449]}
fttpvvtemqvipvaghdsmlmnlggahaafftrniviikdnsghtgvgeipggekirkt
ledaiplvvgktlgeyknvltlvrntfadrdaggrglqtfdlrttihvvtgieaamldll
gqhlgvnvasllg
>d3pwgd1 d.54.1.0 (D:5-137) automated matches {Escherichia coli [TaxId: 444449]}
fttpvvtemqvipvaghdsmlmnlggahaafftrniviikdnsghtgvgeipggekirkt
ledaiplvvgktlgeyknvltlvrntfattihvvtgieaamldllgqhlgvnvasllg
Timeline for d3pwgd1: