Lineage for d3pmea2 (3pme A:1086-1280)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2053108Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2053846Superfamily b.42.4: STI-like [50386] (3 families) (S)
  5. 2053956Family b.42.4.0: automated matches [191368] (1 protein)
    not a true family
  6. 2053957Protein automated matches [190445] (6 species)
    not a true protein
  7. 2053963Species Clostridium botulinum [TaxId:1491] [225676] (22 PDB entries)
  8. 2053964Domain d3pmea2: 3pme A:1086-1280 [233259]
    Other proteins in same PDB: d3pmea1, d3pmea3
    automated match to d3btaa2
    complexed with gol, so4

Details for d3pmea2

PDB Entry: 3pme (more details), 1.56 Å

PDB Description: Crystal structure of the receptor binding domain of botulinum neurotoxin C/D mosaic serotype
PDB Compounds: (A:) Type C neurotoxin

SCOPe Domain Sequences for d3pmea2:

Sequence, based on SEQRES records: (download)

>d3pmea2 b.42.4.0 (A:1086-1280) automated matches {Clostridium botulinum [TaxId: 1491]}
rnvikdywgnplkfdteyyminynyidryiapknnilvlvqysdisklytknpitiksaa
nknpysrilngddimfhmlydsreymiirdtdtiyatqggqcskncvyalklqsnlgnyg
igifsiknivsqnkycsqifssfmkntmlladiykpwrfsfenaytpvavtnyetkllst
ssfwkfisrdpgwve

Sequence, based on observed residues (ATOM records): (download)

>d3pmea2 b.42.4.0 (A:1086-1280) automated matches {Clostridium botulinum [TaxId: 1491]}
rnvikdywgnplkfdteyyminynyidryiapknnilvlvqysdisklytknpitiksaa
nknpysrilngddimfhmlydsreymiirdtdtiyatqggqcskncvyalklqsnlgnyg
igifsiknivsqycsqifssfmkntmlladiykpwrfsfenaytpvavtnyetkllstss
fwkfisrdpgwve

SCOPe Domain Coordinates for d3pmea2:

Click to download the PDB-style file with coordinates for d3pmea2.
(The format of our PDB-style files is described here.)

Timeline for d3pmea2: