Lineage for d3phzb2 (3phz B:149-286)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2173267Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2173268Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2174174Family d.3.1.0: automated matches [191342] (1 protein)
    not a true family
  6. 2174175Protein automated matches [190230] (20 species)
    not a true protein
  7. 2174300Species Polyporus squamosus [TaxId:5640] [233246] (2 PDB entries)
  8. 2174302Domain d3phzb2: 3phz B:149-286 [233248]
    Other proteins in same PDB: d3phza1, d3phzb1
    automated match to d2ihoa2
    complexed with sia

Details for d3phzb2

PDB Entry: 3phz (more details), 1.7 Å

PDB Description: crystal structure analysis of polyporus squamosus lectin bound to human-type influenza-binding epitope neu5aca2-6galb1-4glcnac
PDB Compounds: (B:) Ricin B-related lectin

SCOPe Domain Sequences for d3phzb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3phzb2 d.3.1.0 (B:149-286) automated matches {Polyporus squamosus [TaxId: 5640]}
lsqtganvhatllacpalrqdfksylsdglylvltrdqissiwqasglgstpwrseifdc
ddfatvfkgavakwgnenfkangfallcglmfgskssgahaynwfvergnfstvtffepq
ngtysanawdykayfglf

SCOPe Domain Coordinates for d3phzb2:

Click to download the PDB-style file with coordinates for d3phzb2.
(The format of our PDB-style files is described here.)

Timeline for d3phzb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3phzb1