![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
![]() | Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) ![]() |
![]() | Family b.42.2.0: automated matches [227190] (1 protein) not a true family |
![]() | Protein automated matches [226913] (9 species) not a true protein |
![]() | Species Polyporus squamosus [TaxId:5640] [233243] (2 PDB entries) |
![]() | Domain d3phzb1: 3phz B:2-148 [233245] Other proteins in same PDB: d3phza2, d3phzb2 automated match to d2ihoa1 complexed with sia |
PDB Entry: 3phz (more details), 1.7 Å
SCOPe Domain Sequences for d3phzb1:
Sequence, based on SEQRES records: (download)
>d3phzb1 b.42.2.0 (B:2-148) automated matches {Polyporus squamosus [TaxId: 5640]} sfqghgiyyiasayvantrlalsedssankspdviissdavdplnnlwliepvgeadtyt vrnafagsymdlaghaatdgtaiigyrptggdnqkwiisqindvwkiksketgtfvtlln gdgggtgtvvgwqnitnntsqnwtfqk
>d3phzb1 b.42.2.0 (B:2-148) automated matches {Polyporus squamosus [TaxId: 5640]} sfqghgiyyiasayvantrlalsenkspdviissdavdplnnlwliepvgeadtytvrna fagsymdlaghaatdgtaiigyrptggdnqkwiisqindvwkiksketgtfvtllnggtg tvvgwqnitnntsqnwtfqk
Timeline for d3phzb1: