SCOPe 2.08: Domain d3phta2: 3pht A:61-144

Lineage for d3phta2 (3pht A:61-144)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.18: ACT-like [55021] (15 families)
   regulatory domain linked to a wide range of metabolic enzymes

5. Family d.58.18.0: automated matches [227175] (1 protein)
   not a true family

6. Protein automated matches [226892] (5 species)
   not a true protein

7. Species Helicobacter pylori [TaxId:210] [233241] (1 PDB entry)

8. Domain d3phta2: 3pht A:61-144 [233242]
   Other proteins in same PDB: d3phta1
   automated match to d2bj9a2
   complexed with ni; mutant

Details for d3phta2

PDB Entry: 3pht, 2.04 Å

PDB Description: Crystal structure of H74A mutant of Helicobacter Pylori NikR

PDB Compounds: (A:) putative nickel-responsive regulator

SCOPe Domain Sequences for d3phta2:

Sequence; same for both SEQRES and ATOM records:

>d3phta2 d.58.18.0 (A:61-144) automated matches {Helicobacter pylori [TaxId: 210]}
deskiavlvviydahqrelnqrmidiqhasgthvlctthihmdehncletiilqgnsfei
qrlqleigglrgvkfakltkassf

Timeline for d3phta2:

• d3phta2 first appeared in SCOPe 2.03
  
• d3phta2 appears in SCOPe 2.07