| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.43: Ribbon-helix-helix [47597] (1 superfamily) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.43.1: Ribbon-helix-helix [47598] (12 families) ![]() formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon |
| Family a.43.1.0: automated matches [230594] (1 protein) not a true family |
| Protein automated matches [230595] (2 species) not a true protein |
| Species Helicobacter pylori [TaxId:210] [233239] (1 PDB entry) |
| Domain d3phta1: 3pht A:29-60 [233240] Other proteins in same PDB: d3phta2 automated match to d2bj9a1 complexed with ni; mutant |
PDB Entry: 3pht (more details), 2.04 Å
SCOPe Domain Sequences for d3phta1:
Sequence, based on SEQRES records: (download)
>d3phta1 a.43.1.0 (A:29-60) automated matches {Helicobacter pylori [TaxId: 210]}
iikngyssrselvrdmireklvednwaednpn
>d3phta1 a.43.1.0 (A:29-60) automated matches {Helicobacter pylori [TaxId: 210]}
iingyssrselvrdmireklvednwaednpn
Timeline for d3phta1: