Lineage for d3phta1 (3pht A:29-60)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1270289Fold a.43: Ribbon-helix-helix [47597] (1 superfamily)
    core: 4 helices; array of 2 hairpins, opened
  4. 1270290Superfamily a.43.1: Ribbon-helix-helix [47598] (12 families) (S)
    formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon
  5. 1270494Family a.43.1.0: automated matches [230594] (1 protein)
    not a true family
  6. 1270495Protein automated matches [230595] (2 species)
    not a true protein
  7. 1270496Species Helicobacter pylori [TaxId:210] [233239] (1 PDB entry)
  8. 1270497Domain d3phta1: 3pht A:29-60 [233240]
    Other proteins in same PDB: d3phta2
    automated match to d2bj9a1
    complexed with ni; mutant

Details for d3phta1

PDB Entry: 3pht (more details), 2.04 Å

PDB Description: Crystal structure of H74A mutant of Helicobacter Pylori NikR
PDB Compounds: (A:) putative nickel-responsive regulator

SCOPe Domain Sequences for d3phta1:

Sequence, based on SEQRES records: (download)

>d3phta1 a.43.1.0 (A:29-60) automated matches {Helicobacter pylori [TaxId: 210]}
iikngyssrselvrdmireklvednwaednpn

Sequence, based on observed residues (ATOM records): (download)

>d3phta1 a.43.1.0 (A:29-60) automated matches {Helicobacter pylori [TaxId: 210]}
iingyssrselvrdmireklvednwaednpn

SCOPe Domain Coordinates for d3phta1:

Click to download the PDB-style file with coordinates for d3phta1.
(The format of our PDB-style files is described here.)

Timeline for d3phta1: