SCOPe 2.06: Domain d2bbvb_: 2bbv B:

Lineage for d2bbvb_ (2bbv B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families)

5. Family b.121.4.4: Nodaviridae-like VP [88638] (1 protein)

6. Protein Alphanodavirus capsid protein [49648] (3 species)

7. Species Black beetle virus [TaxId:12285] [49649] (1 PDB entry)

8. Domain d2bbvb_: 2bbv B: [23324]
   protein/RNA complex; complexed with ca

Details for d2bbvb_

PDB Entry: 2bbv, 2.8 Å

PDB Description: the refined three-dimensional structure of an insect virus at 2.8 angstroms resolution

PDB Compounds: (B:) protein (black beetle virus capsid protein)

SCOPe Domain Sequences for d2bbvb_:

Sequence; same for both SEQRES and ATOM records:

>d2bbvb_ b.121.4.4 (B:) Alphanodavirus capsid protein {Black beetle virus [TaxId: 12285]}
ltrlsqpglaflkcafappdfntdpgkgipdrfegkvvtrkdvlnqsinftanrdtfili
aptpgvaywvadvpagtfpistttfnavnfpgfnsmfgnaaasrsdqvssfryasmnvgi
yptsnlmqfagsitvwkcpvklsnvqfpvattpatsalvhtlvgldgvlavgpdnfsesf
ikgvfsqsvcnepdfefsdilegiqtlppanvtvatsgqpfnlaagaeavsgivgwgnmd
tivirvsaptgavnsailktwacleyrpnpnamlyqfghdsppcdevalqeyrtvarslp
vaviaaqn

Timeline for d2bbvb_:

• d2bbvb_ first appeared (with stable ids) in SCOP 1.55
  
• d2bbvb_ appears in SCOPe 2.05
  
• d2bbvb_ appears in SCOPe 2.07
  
• d2bbvb_ appears in the current release, SCOPe 2.08