| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
| Protein automated matches [190069] (319 species) not a true protein |
| Species Geobacter sulfurreducens [TaxId:35554] [233218] (1 PDB entry) |
| Domain d3pduf1: 3pdu F:2-163 [233229] Other proteins in same PDB: d3pdua2, d3pdua3, d3pdub2, d3pdub3, d3pduc2, d3pduc3, d3pdud2, d3pdud3, d3pdue2, d3pdue3, d3pduf2, d3pduf3, d3pdug2, d3pduh2, d3pduh3 automated match to d2i9pa1 complexed with gol, nap |
PDB Entry: 3pdu (more details), 1.89 Å
SCOPe Domain Sequences for d3pduf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pduf1 c.2.1.0 (F:2-163) automated matches {Geobacter sulfurreducens [TaxId: 35554]}
ttygflglgimggpmaanlvragfdvtvwnrnpakcaplvalgarqasspaevcaacdit
iamladpaaarevcfgangvlegigggrgyidmstvddetstaigaavtarggrfleapv
sgtkkpaedgtliilaagdqslftdagpafaalgkkclhlge
Timeline for d3pduf1: