Lineage for d3pdub2 (3pdu B:164-286)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006475Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2006476Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2006685Family a.100.1.0: automated matches [227147] (1 protein)
    not a true family
  6. 2006686Protein automated matches [226851] (35 species)
    not a true protein
  7. 2006756Species Geobacter sulfurreducens [TaxId:35554] [233220] (1 PDB entry)
  8. 2006758Domain d3pdub2: 3pdu B:164-286 [233225]
    Other proteins in same PDB: d3pdua1, d3pdua3, d3pdub1, d3pdub3, d3pduc1, d3pduc3, d3pdud1, d3pdud3, d3pdue1, d3pdue3, d3pduf1, d3pduf3, d3pdug1, d3pduh1, d3pduh3
    automated match to d2i9pa2
    complexed with gol, nap

Details for d3pdub2

PDB Entry: 3pdu (more details), 1.89 Å

PDB Description: crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter sulfurreducens in complex with nadp+
PDB Compounds: (B:) 3-hydroxyisobutyrate dehydrogenase family protein

SCOPe Domain Sequences for d3pdub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pdub2 a.100.1.0 (B:164-286) automated matches {Geobacter sulfurreducens [TaxId: 35554]}
vgqgarmklvvnmimgqmmtalgegmalgrncgldggqllevldagamanpmfkgkgqml
lsgefptsfplkhmqkdlrlavelgdrlgqplhgaatanesfkraraaghadedfaavfr
vle

SCOPe Domain Coordinates for d3pdub2:

Click to download the PDB-style file with coordinates for d3pdub2.
(The format of our PDB-style files is described here.)

Timeline for d3pdub2: