SCOPe 2.03: Domain d3pdub1: 3pdu B:2-163

Lineage for d3pdub1 (3pdu B:2-163)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (159 species)
   not a true protein

7. Species Geobacter sulfurreducens [TaxId:35554] [233218] (1 PDB entry)

8. Domain d3pdub1: 3pdu B:2-163 [233223]
   Other proteins in same PDB: d3pdua2, d3pdub2, d3pduc2, d3pdud2, d3pdue2, d3pduf2
   automated match to d2i9pa1
   complexed with gol, nap

Details for d3pdub1

PDB Entry: 3pdu, 1.89 Å

PDB Description: crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter sulfurreducens in complex with nadp+

PDB Compounds: (B:) 3-hydroxyisobutyrate dehydrogenase family protein

SCOPe Domain Sequences for d3pdub1:

Sequence; same for both SEQRES and ATOM records:

>d3pdub1 c.2.1.0 (B:2-163) automated matches {Geobacter sulfurreducens [TaxId: 35554]}
ttygflglgimggpmaanlvragfdvtvwnrnpakcaplvalgarqasspaevcaacdit
iamladpaaarevcfgangvlegigggrgyidmstvddetstaigaavtarggrfleapv
sgtkkpaedgtliilaagdqslftdagpafaalgkkclhlge

Timeline for d3pdub1:

• d3pdub1 is new in SCOPe 2.03-stable
  
• d3pdub1 appears in SCOPe 2.04
  
• d3pdub1 appears in the current release, SCOPe 2.08