Lineage for d1f15c_ (1f15 C:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily) Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families) 
Family b.10.1.2: Plant virus proteins [49616] (15 proteins) 
Protein CMV coat protein [49645] (1 species) Species Cucumber mosaic virus, strain fny [TaxId:12305] [49646] (1 PDB entry) 
Domain d1f15c_: 1f15 C: [23322]
Details for d1f15c_
PDB Entry: 1f15 (more details), 3.2 Å
PDB Description: cucumber mosaic virus (strain fny)
SCOP Domain Sequences for d1f15c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f15c_ b.10.1.2 (C:) CMV coat protein {Cucumber mosaic virus, strain fny}
adanfrvlsqqlsrlnktlaagrptinhptfvgsercrpgytftsitlkppkidrgsyyg
krlllpdsvteydkklvsrlqirvnplpkfdstvwvtvrkvpassdlsvaaisamfadga
spvlvyqyaasgvqannkllydlsamradigdmrkyavlvyskddaletdelvlhvdieh
qriptsgvlpv
SCOP Domain Coordinates for d1f15c_:
Click to download the PDB-style file with coordinates for d1f15c_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1f15c_:
- d1f15c_ appears in SCOP 1.57
- d1f15c_ appears in the current release, SCOPe 2.08
View in 3D
