| Class b: All beta proteins [48724] (180 folds) |
| Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) ![]() |
| Family b.121.4.5: Bromoviridae-like VP [88639] (2 proteins) |
| Protein Cucumovirus coat protein [88640] (4 species) |
| Species CMV (Cucumber mosaic virus), strain fny [TaxId:12305] [49646] (1 PDB entry) |
| Domain d1f15c_: 1f15 C: [23322] |
PDB Entry: 1f15 (more details), 3.2 Å
SCOPe Domain Sequences for d1f15c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f15c_ b.121.4.5 (C:) Cucumovirus coat protein {CMV (Cucumber mosaic virus), strain fny [TaxId: 12305]}
adanfrvlsqqlsrlnktlaagrptinhptfvgsercrpgytftsitlkppkidrgsyyg
krlllpdsvteydkklvsrlqirvnplpkfdstvwvtvrkvpassdlsvaaisamfadga
spvlvyqyaasgvqannkllydlsamradigdmrkyavlvyskddaletdelvlhvdieh
qriptsgvlpv
Timeline for d1f15c_: