SCOPe 2.07: Domain d3pdfa2: 3pdf A:206-439

Lineage for d3pdfa2 (3pdf A:206-439)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.1: Papain-like [54002] (26 proteins)

6. Protein automated matches [190264] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187102] (9 PDB entries)

8. Domain d3pdfa2: 3pdf A:206-439 [233217]
   Other proteins in same PDB: d3pdfa1, d3pdfa3
   automated match to d1jqpa2
   complexed with cl, lxv, nag

Details for d3pdfa2

PDB Entry: 3pdf, 1.85 Å

PDB Description: discovery of novel cyanamide-based inhibitors of cathepsin c

PDB Compounds: (A:) Dipeptidyl peptidase 1

SCOPe Domain Sequences for d3pdfa2:

Sequence, based on SEQRES records:

>d3pdfa2 d.3.1.1 (A:206-439) automated matches {Human (Homo sapiens) [TaxId: 9606]}
flptswdwrnvhginfvspvrnqascgscysfasmgmleaririltnnsqtpilspqevv
scsqyaqgceggfpyliagkyaqdfglveeacfpytgtdspckmkedcfryysseyhyvg
gfyggcnealmklelvhhgpmavafevyddflhykkgiyhhtglrdpfnpfeltnhavll
vgygtdsasgmdywivknswgtgwgengyfrirrgtdecaiesiavaatpipkl

Sequence, based on observed residues (ATOM records):

>d3pdfa2 d.3.1.1 (A:206-439) automated matches {Human (Homo sapiens) [TaxId: 9606]}
flptswdwrnvhginfvspvrnqascgscysfasmgmleaririltnnsqtpilspqevv
scsqyaqgceggfpyliagkyaqdfglveeacfpytgtdspckmkedcfryysseyhyvg
gfyggcnealmklelvhhgpmavafevyddflhykkgiyhhtdpfnpfeltnhavllvgy
gtdsasgmdywivknswgtgwgengyfrirrgtdecaiesiavaatpipkl

Timeline for d3pdfa2:

• d3pdfa2 first appeared in SCOPe 2.03
  
• d3pdfa2 appears in SCOPe 2.06
  
• d3pdfa2 appears in the current release, SCOPe 2.08